(data stored in ACNUC7421 zone)

EMBL: CP001022.PE303

CP001022.PE303       Location/Qualifiers
FT   CDS             complement(320283..320621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0305"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: btl:BALH_0853 transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59791"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI07"
FT                   /protein_id="ACB59791.1"
FT                   /translation="MKHTGRHTGAFLLLFLAKGPTYGGDLLQRCEQELPFNPIDSAILY
FT                   RTLKKLEEEGFVTSILTTSPRNKMVKMYQITSSGRAQLDRFHEDIEQKLQNLLYFQTHY
FT                   AKQVKSDG"
     MKHTGRHTGA FLLLFLAKGP TYGGDLLQRC EQELPFNPID SAILYRTLKK LEEEGFVTSI        60
     LTTSPRNKMV KMYQITSSGR AQLDRFHEDI EQKLQNLLYF QTHYAKQVKS DG               112
//

If you have problems or comments...

PBIL Back to PBIL home page