(data stored in ACNUC7421 zone)

EMBL: CP001022.PE309

CP001022.PE309       Location/Qualifiers
FT   CDS             324841..325269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59797"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB4"
FT                   /protein_id="ACB59797.1"
FT                   /translation="MLIPEKETVVKMISERYNCALTIMKQKKIMYEGTTRNDKSVVLCT
FT                   PETKLHNQEHGWFDLSTKQVEILDGADMAIMAVRIEGNKVYFVEFKNLRRLMTADMILD
FT                   YSKDEKWRFYIWEDHIKVRGNDEKFYVSGEVVKTVEHV"
     MLIPEKETVV KMISERYNCA LTIMKQKKIM YEGTTRNDKS VVLCTPETKL HNQEHGWFDL        60
     STKQVEILDG ADMAIMAVRI EGNKVYFVEF KNLRRLMTAD MILDYSKDEK WRFYIWEDHI       120
     KVRGNDEKFY VSGEVVKTVE HV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page