(data stored in ACNUC7421 zone)

EMBL: CP001022.PE310

CP001022.PE310       Location/Qualifiers
FT   CDS             325862..326458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0312"
FT                   /product="Protein of unkown function DUF1819 putative inner
FT                   membrane"
FT                   /note="PFAM: Protein of unkown function DUF1819 putative
FT                   inner membrane; KEGG: chy:CHY_2656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59798"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB5"
FT                   /protein_id="ACB59798.1"
FT                   /translation="MTIELEYSSSMNGASYLLFELKQVVKLKQEGFSIEEIRSKVVDEN
FT                   LFQFENKGRIKRTLPSVMKRAHVIDSALAILMLEGSIEMSKVINLYAIMKTDLLFFEFM
FT                   DEVISEKLRNGDYLIEKKDINLFFEAKLEQSEKISSWSDINIEKLKRAFMQVLFESGFL
FT                   KSRQSKELGHIIIDEQIKEYLNRIGDVRYVRAMGE"
     MTIELEYSSS MNGASYLLFE LKQVVKLKQE GFSIEEIRSK VVDENLFQFE NKGRIKRTLP        60
     SVMKRAHVID SALAILMLEG SIEMSKVINL YAIMKTDLLF FEFMDEVISE KLRNGDYLIE       120
     KKDINLFFEA KLEQSEKISS WSDINIEKLK RAFMQVLFES GFLKSRQSKE LGHIIIDEQI       180
     KEYLNRIGDV RYVRAMGE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page