(data stored in ACNUC7421 zone)

EMBL: CP001022.PE314

CP001022.PE314       Location/Qualifiers
FT   CDS             334297..336855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0316"
FT                   /product="PglZ domain protein"
FT                   /note="PFAM: PglZ domain protein; KEGG: swo:Swol_2489
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59802"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR014060"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB9"
FT                   /protein_id="ACB59802.1"
FT                   /translation="MNMAQIESTLQDIFNEPLKDGEQRKLVFWVDKDEEFTEEIGQLAL
FT                   PNVKVQALSDRNSFYIKHLLEEEDSTSFYLIYTTLELSVEDNWLVDTVLYSKTFFADRI
FT                   SLILNELQIDSSLRAIIKKHERFFNNKERFRKFQSFAIESYSEETIELAIMSVLCNVKT
FT                   PDFEAVLKEVLIDTLDEGENKLLSQLERFFDMDIFWRYVANYYGYVRETKTLKTLFIHL
FT                   TVTAFTHSISDEYLTSVKDFIAVRNKANALVFIDHWMHHKTDSIVFDQYAEMVEQEIKL
FT                   PSILQDIPVDEFKQADTFPYIDKVIIIYIANNLMERLEDYEEYTKLIKLRRVKHYYEKY
FT                   ASIYEALYYTVKMQEFYKAHQQGISQGSVIDLYKAYRDEYFVMDTYYRKFYVAYDEESN
FT                   HELVKKLKELVEHLYTNWFIGELSSHWSQSVKSEMVEEWSLPGITSQQSFYSSAVAPHV
FT                   RKGERVFVIVSDAMRYEVGLELIDLLNFETTGICEMQSMLGVVPSVTKLGMAALLPHRK
FT                   LDFDENGRVLVDGKDSAGLENRKKIIESYVEDSLAIHFQDMLAMNKAARRETFKGKRVV
FT                   YIYHDTIDAMGDKASTEIYTFNAVETSLNQLKALVKMIRDDLGGTNIYVTADHGFLYQR
FT                   DALEDSDKISNEVLNAVEVKRRYVLSKEKRKISGQLGINLSSIVDNEEQLTAYVPNGTI
FT                   RNRMQGTGVNFVHGGASLQEVVVPLVVYKNKRAGQKGSYALQKVDIKLTSSTRKITNSI
FT                   FNLNFFQTEKVEDKMIPRTVVICIEDIDGTVLSNEETIIGDRTFDNPGDRIFKLQFVLK
FT                   SISYDRNKMYYLLVKDLETGVVTEKIPFSISLGIVSDFDF"
     MNMAQIESTL QDIFNEPLKD GEQRKLVFWV DKDEEFTEEI GQLALPNVKV QALSDRNSFY        60
     IKHLLEEEDS TSFYLIYTTL ELSVEDNWLV DTVLYSKTFF ADRISLILNE LQIDSSLRAI       120
     IKKHERFFNN KERFRKFQSF AIESYSEETI ELAIMSVLCN VKTPDFEAVL KEVLIDTLDE       180
     GENKLLSQLE RFFDMDIFWR YVANYYGYVR ETKTLKTLFI HLTVTAFTHS ISDEYLTSVK       240
     DFIAVRNKAN ALVFIDHWMH HKTDSIVFDQ YAEMVEQEIK LPSILQDIPV DEFKQADTFP       300
     YIDKVIIIYI ANNLMERLED YEEYTKLIKL RRVKHYYEKY ASIYEALYYT VKMQEFYKAH       360
     QQGISQGSVI DLYKAYRDEY FVMDTYYRKF YVAYDEESNH ELVKKLKELV EHLYTNWFIG       420
     ELSSHWSQSV KSEMVEEWSL PGITSQQSFY SSAVAPHVRK GERVFVIVSD AMRYEVGLEL       480
     IDLLNFETTG ICEMQSMLGV VPSVTKLGMA ALLPHRKLDF DENGRVLVDG KDSAGLENRK       540
     KIIESYVEDS LAIHFQDMLA MNKAARRETF KGKRVVYIYH DTIDAMGDKA STEIYTFNAV       600
     ETSLNQLKAL VKMIRDDLGG TNIYVTADHG FLYQRDALED SDKISNEVLN AVEVKRRYVL       660
     SKEKRKISGQ LGINLSSIVD NEEQLTAYVP NGTIRNRMQG TGVNFVHGGA SLQEVVVPLV       720
     VYKNKRAGQK GSYALQKVDI KLTSSTRKIT NSIFNLNFFQ TEKVEDKMIP RTVVICIEDI       780
     DGTVLSNEET IIGDRTFDNP GDRIFKLQFV LKSISYDRNK MYYLLVKDLE TGVVTEKIPF       840
     SISLGIVSDF DF                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page