(data stored in ACNUC7421 zone)

EMBL: CP001022.PE318

CP001022.PE318       Location/Qualifiers
FT   CDS             complement(341418..341846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0320"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; 3-demethylubiquinone-9
FT                   3-methyltransferase; KEGG: cac:CAC3689 uncharacterized
FT                   conserved protein, phnB family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59806"
FT                   /db_xref="GOA:B1YIC3"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC3"
FT                   /protein_id="ACB59806.1"
FT                   /translation="MPITPYLVFNGNTREAIHYYAKVFGQDVPDIMEFGPGNGPDGQPF
FT                   EKDVQSLVLHSQLIVHGTRVMFSDAMPHDPVAIGQNVTLALHLPDIQVIHETFDKLAQD
FT                   GNIIMPIQKTFWSEAYGIVKDPFGVQWQLNHEVSEIAE"
     MPITPYLVFN GNTREAIHYY AKVFGQDVPD IMEFGPGNGP DGQPFEKDVQ SLVLHSQLIV        60
     HGTRVMFSDA MPHDPVAIGQ NVTLALHLPD IQVIHETFDK LAQDGNIIMP IQKTFWSEAY       120
     GIVKDPFGVQ WQLNHEVSEI AE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page