(data stored in ACNUC7421 zone)

EMBL: CP001022.PE321

CP001022.PE321       Location/Qualifiers
FT   CDS             344965..345912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0324"
FT                   /product="Carbohydrate-binding CenC domain protein"
FT                   /note="PFAM: Carbohydrate-binding CenC domain protein;
FT                   KEGG: cth:Cthe_2809 glycoside hydrolase, family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59809"
FT                   /db_xref="GOA:B1YIC6"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC6"
FT                   /protein_id="ACB59809.1"
FT                   /translation="MRVSSPDFNKYTGKDYHFPDSGQLEQWHTYAVDYVRVYDLTNRDY
FT                   REPVDPVTRDFTFKAKAQMKKGQTATLTQRGVQLQEDHQYVLRFKADSKRSKQIQVKAK
FT                   NADGTTAYLPTHDVPLTKQTTTVDIPFTMTQATDLNSQLQFNFGTAKGEVTLDDVELMD
FT                   VTPIEVDRSPLKNGSFTDGLNFWSSYVHYDAQAVVSTVNDAAKLAIASEGQEPWSVLLE
FT                   QGNLQLVKGQTYQLTFKASSTVARPLEVTVENAAYTRYFSQIVELGTEAKTYQFDFTLG
FT                   QDDTAGLKFLLGKAAGSPFAAHDVTIDDVKLEVK"
     MRVSSPDFNK YTGKDYHFPD SGQLEQWHTY AVDYVRVYDL TNRDYREPVD PVTRDFTFKA        60
     KAQMKKGQTA TLTQRGVQLQ EDHQYVLRFK ADSKRSKQIQ VKAKNADGTT AYLPTHDVPL       120
     TKQTTTVDIP FTMTQATDLN SQLQFNFGTA KGEVTLDDVE LMDVTPIEVD RSPLKNGSFT       180
     DGLNFWSSYV HYDAQAVVST VNDAAKLAIA SEGQEPWSVL LEQGNLQLVK GQTYQLTFKA       240
     SSTVARPLEV TVENAAYTRY FSQIVELGTE AKTYQFDFTL GQDDTAGLKF LLGKAAGSPF       300
     AAHDVTIDDV KLEVK                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page