(data stored in ACNUC7421 zone)

EMBL: CP001022.PE323

CP001022.PE323       Location/Qualifiers
FT   CDS             complement(346604..347875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0326"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M20; peptidase M42 family protein;
FT                   KEGG: pth:PTH_1208 di- and tripeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59811"
FT                   /db_xref="GOA:B1YIC8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC8"
FT                   /protein_id="ACB59811.1"
FT                   /translation="MTNATILLARHGLSRDDQFNKTHVACLTDSILQYPVVDWNDRQLI
FT                   EWIQQVPFENLPGREAMIDPSTNDLPYQSFDPYIRGIVRWLNALDIPTLSCCDGHGRGR
FT                   ASVVLKQAPSLKQWQLLQLALPYQMTMGLTQLTLHLDYRKSGFPSLLLLAERLYRLTED
FT                   RTYLETLRLEQFKHRLLTWLDIPGVSKRERLVAMHLRNHLRSSTDFLYTDKRGNVLATI
FT                   QCGVGPTVLLSAHMDTVELIEEDRTILEDGTTLRSSSGILGADDRAGITAILEVLDRVQ
FT                   NTNFSGTLKLAFTVQEEIGCRGAEGIDPEFLHDVDGAIVVDRRGTRDIVTACRNQIPFC
FT                   IQEFGQLFEEAGCLAGMTDWQTTTNGGSSDAKVFAGFGIPSVNLSVGYTHEHTEHETVD
FT                   YAATFETVTLIESVLHHQLIPLRT"
     MTNATILLAR HGLSRDDQFN KTHVACLTDS ILQYPVVDWN DRQLIEWIQQ VPFENLPGRE        60
     AMIDPSTNDL PYQSFDPYIR GIVRWLNALD IPTLSCCDGH GRGRASVVLK QAPSLKQWQL       120
     LQLALPYQMT MGLTQLTLHL DYRKSGFPSL LLLAERLYRL TEDRTYLETL RLEQFKHRLL       180
     TWLDIPGVSK RERLVAMHLR NHLRSSTDFL YTDKRGNVLA TIQCGVGPTV LLSAHMDTVE       240
     LIEEDRTILE DGTTLRSSSG ILGADDRAGI TAILEVLDRV QNTNFSGTLK LAFTVQEEIG       300
     CRGAEGIDPE FLHDVDGAIV VDRRGTRDIV TACRNQIPFC IQEFGQLFEE AGCLAGMTDW       360
     QTTTNGGSSD AKVFAGFGIP SVNLSVGYTH EHTEHETVDY AATFETVTLI ESVLHHQLIP       420
     LRT                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page