(data stored in ACNUC7421 zone)

EMBL: CP001022.PE325

CP001022.PE325       Location/Qualifiers
FT   CDS             complement(349149..350087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0328"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3950
FT                   transposase (10)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59813"
FT                   /db_xref="GOA:B1YE98"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1YE98"
FT                   /protein_id="ACB59813.1"
FT                   /translation="MSYIHLTISERVKIETYLELGFSVRKIAGRLGRQPSTISRELKRN
FT                   PHYDSSHADQRYVERKKKCGARTKFTLEKGICILEKLRETWSPEQIAGRLFQEEGLSFK
FT                   TIYRWIYSGLVEADSGLLRQKGKRQKPRETRGRFNVGLPISKRPSDVKGRQTFGHWELD
FT                   TVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTD
FT                   RGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIA
FT                   QALAWINGRPRKCLNWKTAYEVFTEEVLHLI"
     MSYIHLTISE RVKIETYLEL GFSVRKIAGR LGRQPSTISR ELKRNPHYDS SHADQRYVER        60
     KKKCGARTKF TLEKGICILE KLRETWSPEQ IAGRLFQEEG LSFKTIYRWI YSGLVEADSG       120
     LLRQKGKRQK PRETRGRFNV GLPISKRPSD VKGRQTFGHW ELDTVVSGRG TSKACVATFV       180
     ERKSRFYLAV PMENRSAQSM ESAIQALHLS FPLGTFQTAT TDRGKEFSCH ERIRDTLGLP       240
     MYFADPYSSW QRGSNENANG LLREFFPKGT DFGKVSRSEI AQALAWINGR PRKCLNWKTA       300
     YEVFTEEVLH LI                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page