(data stored in ACNUC7421 zone)

EMBL: CP001022.PE33

CP001022.PE33        Location/Qualifiers
FT   CDS             50689..51978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0034"
FT                   /product="3D domain protein"
FT                   /note="PFAM: protein of unknown function DUF348; 3D domain
FT                   protein; G5 domain protein; KEGG: gtn:GTNG_0032
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59521"
FT                   /db_xref="GOA:B1YGN8"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGN8"
FT                   /protein_id="ACB59521.1"
FT                   /translation="MIRSITYMTIGCTLLLVASLLYMMMDHPRDVTILVDGRQTKIETV
FT                   ETSVFGVLKEAGISVRSQDVIEPALSADLPKNDLIVIQPAKEITLIMGYGEARTIRTQA
FT                   RRVEDLLKEQGISQMLETDDVYPSKEAVLTSGMTVRYREAFPIELIVEGKAREVYTYQT
FT                   TVRELLSMQGVKLQTEDKVMPGLDTVVAKDMLVTVNTTRRAVLTEQQLLPFEVETVEDD
FT                   TLPAGEQLVTKSGRPGIRTQKYQLTLADGLSKEKKLIANEVTSEPVKQVVKIGTKPVES
FT                   VEAATTPAPTFDQEKATVPLAEEPKAATDLDFSKAKTLMVEATAYTNDPASNGSQLYDG
FT                   RALTATGYDVTDTITYQGLPIIAVDPKVIPLGTKVYVEGVGLAIALDTGGAIKGNKIDV
FT                   LVEGESTAKTFGRKTIQIWVIPNETTEAGT"
     MIRSITYMTI GCTLLLVASL LYMMMDHPRD VTILVDGRQT KIETVETSVF GVLKEAGISV        60
     RSQDVIEPAL SADLPKNDLI VIQPAKEITL IMGYGEARTI RTQARRVEDL LKEQGISQML       120
     ETDDVYPSKE AVLTSGMTVR YREAFPIELI VEGKAREVYT YQTTVRELLS MQGVKLQTED       180
     KVMPGLDTVV AKDMLVTVNT TRRAVLTEQQ LLPFEVETVE DDTLPAGEQL VTKSGRPGIR       240
     TQKYQLTLAD GLSKEKKLIA NEVTSEPVKQ VVKIGTKPVE SVEAATTPAP TFDQEKATVP       300
     LAEEPKAATD LDFSKAKTLM VEATAYTNDP ASNGSQLYDG RALTATGYDV TDTITYQGLP       360
     IIAVDPKVIP LGTKVYVEGV GLAIALDTGG AIKGNKIDVL VEGESTAKTF GRKTIQIWVI       420
     PNETTEAGT                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page