(data stored in ACNUC7421 zone)

EMBL: CP001022.PE333

CP001022.PE333       Location/Qualifiers
FT   CDS             356946..357245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0336"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: sgo:SGO_0842
FT                   rhodanese family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59821"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID8"
FT                   /protein_id="ACB59821.1"
FT                   /translation="MKNMSTNELEEILQQEKTIQLIDVRETDEYAVGHIKQAKNLPLSE
FT                   LSERTDELDAGRPLHVICLSGGRSMNASTYLEQAGFDVTNVDGGMMSWEGDVTK"
     MKNMSTNELE EILQQEKTIQ LIDVRETDEY AVGHIKQAKN LPLSELSERT DELDAGRPLH        60
     VICLSGGRSM NASTYLEQAG FDVTNVDGGM MSWEGDVTK                               99
//

If you have problems or comments...

PBIL Back to PBIL home page