(data stored in ACNUC7421 zone)

EMBL: CP001022.PE335

CP001022.PE335       Location/Qualifiers
FT   CDS             358866..360671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0338"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: bsu:BSU09390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59823"
FT                   /db_xref="GOA:B1YIE0"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE0"
FT                   /protein_id="ACB59823.1"
FT                   /translation="MKNFWNTTSFDVNGILGTLGNILGALIVFLIGWLIAKLIANGIQK
FT                   ALEKSGVVNKLSPQKEGTPPQKKKWTPEKIIGTVIFWVLMVFVLILVFNILNLNIIAGP
FT                   LADTMSTLLAAIPNILKAALILLFAYVIAVVLRMIIVKGGTKLMSNEKVRSNKMLQGQT
FT                   DLSNYPKIAGEIVFYLVLLLFLPGVLGALNIESVSEPFSQLLSSFLGFIPRLIAAAAIF
FT                   FVGFLVAKIVRDIVTNFLHAVGTDKFASRFNIGTNEQKDTKSLSSILGTVVFILILIPI
FT                   TISALDQLNIKGITGPAINMLNDVLGMIPNIIIGVVLILVGLYVGRFVKKFVADLLSRL
FT                   GFNNLTRHLKIGNWDANNASTSPSSIVGSLVEIVIVVLFVVEAFNLIGLDFMVDLGRAV
FT                   LAFLPSVLTAIIILAIGIIISNLVKRTMDSLFANSDLKVLSSVAKYAILALAVFMALDQ
FT                   LGVAATIVNSAFILILGAVALAFGLAFGLGGRDNASRYLDRLQKKAENADIDTSNLPSN
FT                   NTSSASTKPSLKEAAKGAASKAADDVTPDQAPKASKPSSSLNVNPTHGTPKGALPKNDL
FT                   AQQDDYPIGPDTNRGPNLDHPNDRP"
     MKNFWNTTSF DVNGILGTLG NILGALIVFL IGWLIAKLIA NGIQKALEKS GVVNKLSPQK        60
     EGTPPQKKKW TPEKIIGTVI FWVLMVFVLI LVFNILNLNI IAGPLADTMS TLLAAIPNIL       120
     KAALILLFAY VIAVVLRMII VKGGTKLMSN EKVRSNKMLQ GQTDLSNYPK IAGEIVFYLV       180
     LLLFLPGVLG ALNIESVSEP FSQLLSSFLG FIPRLIAAAA IFFVGFLVAK IVRDIVTNFL       240
     HAVGTDKFAS RFNIGTNEQK DTKSLSSILG TVVFILILIP ITISALDQLN IKGITGPAIN       300
     MLNDVLGMIP NIIIGVVLIL VGLYVGRFVK KFVADLLSRL GFNNLTRHLK IGNWDANNAS       360
     TSPSSIVGSL VEIVIVVLFV VEAFNLIGLD FMVDLGRAVL AFLPSVLTAI IILAIGIIIS       420
     NLVKRTMDSL FANSDLKVLS SVAKYAILAL AVFMALDQLG VAATIVNSAF ILILGAVALA       480
     FGLAFGLGGR DNASRYLDRL QKKAENADID TSNLPSNNTS SASTKPSLKE AAKGAASKAA       540
     DDVTPDQAPK ASKPSSSLNV NPTHGTPKGA LPKNDLAQQD DYPIGPDTNR GPNLDHPNDR       600
     P                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page