(data stored in ACNUC7421 zone)

EMBL: CP001022.PE34

CP001022.PE34        Location/Qualifiers
FT   CDS             52045..52605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0035"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="KEGG: oih:OB0049 hypothetical protein; TIGRFAM:
FT                   primase/topoisomerase like protein; PFAM: TOPRIM domain
FT                   protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59522"
FT                   /db_xref="GOA:B1YGN9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGN9"
FT                   /protein_id="ACB59522.1"
FT                   /translation="MMRKRLKEVIVVEGRDDTTRLQEVFDVDTIETNGSAVNEQTLQRI
FT                   AKALERRGVIVFTDPDFPGDRIRARINERVPGCKQAYLPRADAKDKRGKIGVEHASPEA
FT                   IERALGAVYETEEQHDAEVTREMILAADLIGGAAASKRRKRLGQLLAIGEPNAKQLVKR
FT                   VASIRITKQEWEDALKQIEEEQD"
     MMRKRLKEVI VVEGRDDTTR LQEVFDVDTI ETNGSAVNEQ TLQRIAKALE RRGVIVFTDP        60
     DFPGDRIRAR INERVPGCKQ AYLPRADAKD KRGKIGVEHA SPEAIERALG AVYETEEQHD       120
     AEVTREMILA ADLIGGAAAS KRRKRLGQLL AIGEPNAKQL VKRVASIRIT KQEWEDALKQ       180
     IEEEQD                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page