(data stored in ACNUC7421 zone)

EMBL: CP001022.PE341

CP001022.PE341       Location/Qualifiers
FT   CDS             365924..366781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0345"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bsu:BSU07900
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59829"
FT                   /db_xref="GOA:B1YIE6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE6"
FT                   /protein_id="ACB59829.1"
FT                   /translation="MSLLKPVFARFFGEAFFDKSAQLAYYLMLSLFPFLLFVVGLVSFL
FT                   PFTSGDVLDLIRPFAPAETYDLIRKNVVGIFDNGGLKLASISFLAAFWLASMSVQSLVR
FT                   SLNDALEVTRKVPFWRGLLQDFGFTVGMMIILPMSLLVPVAEKLTRRFITHFAIVNDVV
FT                   TNYSWIWFLFRWGLGSLFLLVFFILLYRVLPSVRLTVRQVLPGALFATIAWQAVSEFFS
FT                   YYAEFGSYDRLYGQLAGIIVLMTWFYLSSVVLMLGGLMNAERMRQKKEAKVLKPEKIKQ
FT                   ETVR"
     MSLLKPVFAR FFGEAFFDKS AQLAYYLMLS LFPFLLFVVG LVSFLPFTSG DVLDLIRPFA        60
     PAETYDLIRK NVVGIFDNGG LKLASISFLA AFWLASMSVQ SLVRSLNDAL EVTRKVPFWR       120
     GLLQDFGFTV GMMIILPMSL LVPVAEKLTR RFITHFAIVN DVVTNYSWIW FLFRWGLGSL       180
     FLLVFFILLY RVLPSVRLTV RQVLPGALFA TIAWQAVSEF FSYYAEFGSY DRLYGQLAGI       240
     IVLMTWFYLS SVVLMLGGLM NAERMRQKKE AKVLKPEKIK QETVR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page