(data stored in ACNUC7421 zone)

EMBL: CP001022.PE342

CP001022.PE342       Location/Qualifiers
FT   CDS             complement(366778..367644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0346"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bha:BH1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59830"
FT                   /db_xref="GOA:B1YIE7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE7"
FT                   /protein_id="ACB59830.1"
FT                   /translation="MDLLLFLVLGAAIGILSGFFGIGGGIILTPLLLILGYTPSTAIVL
FT                   SLLLTLGSTVTGTFAHLRQNNFHLRDAVTIGVSGIIGSAAITPVVFWMERHSGADTVIS
FT                   TLYIVLLLLFAIQFLKPAKKVVQETPVPHASFYKLVAIGAAAGILSSLMGVSGGFLLTP
FT                   LLMGWVRFPLKQAIGTSIAAATLIVLGGVTSYFMSGTQAPLALGIALIIGALIGSPLGA
FT                   SFLNLFSSQFVKKSLGSFYAAVAASVFLKTTHYEQLSLLLLALFTTGLIGVFFYQKVIQ
FT                   RQTKDCP"
     MDLLLFLVLG AAIGILSGFF GIGGGIILTP LLLILGYTPS TAIVLSLLLT LGSTVTGTFA        60
     HLRQNNFHLR DAVTIGVSGI IGSAAITPVV FWMERHSGAD TVISTLYIVL LLLFAIQFLK       120
     PAKKVVQETP VPHASFYKLV AIGAAAGILS SLMGVSGGFL LTPLLMGWVR FPLKQAIGTS       180
     IAAATLIVLG GVTSYFMSGT QAPLALGIAL IIGALIGSPL GASFLNLFSS QFVKKSLGSF       240
     YAAVAASVFL KTTHYEQLSL LLLALFTTGL IGVFFYQKVI QRQTKDCP                    288
//

If you have problems or comments...

PBIL Back to PBIL home page