(data stored in ACNUC7421 zone)

EMBL: CP001022.PE343

CP001022.PE343       Location/Qualifiers
FT   CDS             367756..368604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0347"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cno:NT01CX_2344 transcription
FT                   regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59831"
FT                   /db_xref="GOA:B1YIE8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE8"
FT                   /protein_id="ACB59831.1"
FT                   /translation="MNFNELKTFVALVETKHFTKTADRLYISQPTVSLHLKHLEEHFGQ
FT                   SLIHRHTFNKTIEISEAGWIVYRHAKEILHQAIRLEQEIDELEGITRGTLRIAATHTIY
FT                   EAMLEEMIHDFLLVYPDVSVDARVMNQEQVEQALLHYEIDLGMVEGLHRSHQIEAIPFA
FT                   TDRLRIIGHHHLVPEQATWIYREEGSAARLALETWLQTQAIVPKRIITVYSNRLIKQLI
FT                   KNGTGISILSERLAGSLLESERFQTYDDSQIDPRMFQFITLKGETTRLSQKWINQHGGS
FT                   D"
     MNFNELKTFV ALVETKHFTK TADRLYISQP TVSLHLKHLE EHFGQSLIHR HTFNKTIEIS        60
     EAGWIVYRHA KEILHQAIRL EQEIDELEGI TRGTLRIAAT HTIYEAMLEE MIHDFLLVYP       120
     DVSVDARVMN QEQVEQALLH YEIDLGMVEG LHRSHQIEAI PFATDRLRII GHHHLVPEQA       180
     TWIYREEGSA ARLALETWLQ TQAIVPKRII TVYSNRLIKQ LIKNGTGISI LSERLAGSLL       240
     ESERFQTYDD SQIDPRMFQF ITLKGETTRL SQKWINQHGG SD                          282
//

If you have problems or comments...

PBIL Back to PBIL home page