(data stored in ACNUC7421 zone)

EMBL: CP001022.PE344

CP001022.PE344       Location/Qualifiers
FT   CDS             368704..368967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0348"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   sar:SAR0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59832"
FT                   /db_xref="GOA:B1YIE9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE9"
FT                   /protein_id="ACB59832.1"
FT                   /translation="MEKVYEDKIIHRMNRIEGQLHGIIRMMKEEASCKDVVTQLSATRS
FT                   AIDRVIGLVVSENLIECVTNDETDDNHEQAVAEAVQLLLKSR"
     MEKVYEDKII HRMNRIEGQL HGIIRMMKEE ASCKDVVTQL SATRSAIDRV IGLVVSENLI        60
     ECVTNDETDD NHEQAVAEAV QLLLKSR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page