(data stored in ACNUC7421 zone)

EMBL: CP001022.PE346

CP001022.PE346       Location/Qualifiers
FT   CDS             369519..369884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0350"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   btk:BT9727_0689 rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59834"
FT                   /db_xref="GOA:B1YIF1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF1"
FT                   /protein_id="ACB59834.1"
FT                   /translation="MQVDILNIVFLVIVAFLAYRMFAPTKGVNKLSASDLKQRLGDRTR
FT                   FYLDVRTPGEFKGNHIKGFKNIPLQVLPTQLDKIPKDKEVIVICQSGMRSKQAVKQLKK
FT                   AGYTQVTEVSGGMNAWR"
     MQVDILNIVF LVIVAFLAYR MFAPTKGVNK LSASDLKQRL GDRTRFYLDV RTPGEFKGNH        60
     IKGFKNIPLQ VLPTQLDKIP KDKEVIVICQ SGMRSKQAVK QLKKAGYTQV TEVSGGMNAW       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page