(data stored in ACNUC7421 zone)

EMBL: CP001022.PE349

CP001022.PE349       Location/Qualifiers
FT   CDS             370851..371987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0353"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein; KEGG: bpu:BPUM_0193 possible zinc
FT                   (Zn) dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59837"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF4"
FT                   /protein_id="ACB59837.1"
FT                   /translation="MAQAMTTKEVTQKIIRREKMFILDVRNEDAFQDWKIEGEQFSYLN
FT                   VPYFDLLDGVEDILDQLPTDQNVLVVCAKEGSSIFVADLLEEAGRTVSYLAGGMKAWSE
FT                   HLEPISLGSLNETGADRGEVVQFVRIGKGCLSYMIISEGEAVLVDATRMTDVYLDYAKE
FT                   RQLEITHVFDTHLHADHISGGREIAEKTGATYWLPPKDAPDVTFDYAALEDGSHVQVGD
FT                   TQIDVRALYSPGHTIGSTSFVVDNRYLLTGDILFIDSIGRPDLAGLAEDWVGDLRDSLY
FT                   NTYRELSKDLIVLPAHFMLIEELNEDGSVAEKLDVLLANNHGLNIEDEETFRKMVTENL
FT                   PPQPNAYQEIRETNMGKQTPDREAQREMEVGPNRCAVR"
     MAQAMTTKEV TQKIIRREKM FILDVRNEDA FQDWKIEGEQ FSYLNVPYFD LLDGVEDILD        60
     QLPTDQNVLV VCAKEGSSIF VADLLEEAGR TVSYLAGGMK AWSEHLEPIS LGSLNETGAD       120
     RGEVVQFVRI GKGCLSYMII SEGEAVLVDA TRMTDVYLDY AKERQLEITH VFDTHLHADH       180
     ISGGREIAEK TGATYWLPPK DAPDVTFDYA ALEDGSHVQV GDTQIDVRAL YSPGHTIGST       240
     SFVVDNRYLL TGDILFIDSI GRPDLAGLAE DWVGDLRDSL YNTYRELSKD LIVLPAHFML       300
     IEELNEDGSV AEKLDVLLAN NHGLNIEDEE TFRKMVTENL PPQPNAYQEI RETNMGKQTP       360
     DREAQREMEV GPNRCAVR                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page