(data stored in ACNUC7421 zone)

EMBL: CP001022.PE352

CP001022.PE352       Location/Qualifiers
FT   CDS             complement(373142..373528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0356"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   gka:GK2063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59840"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF7"
FT                   /protein_id="ACB59840.1"
FT                   /translation="MFDYTVSSNHSTEETIERLKTALAEISFGVLWEFDLAKKFAEKEL
FT                   PFDDQYHILEVCNPIEAHRVLSAERRAGYFLPCKLAVYTEDGQTKIGMPRPTSLIGLVE
FT                   EDELKQVALDVERQLVDVIEKSRL"
     MFDYTVSSNH STEETIERLK TALAEISFGV LWEFDLAKKF AEKELPFDDQ YHILEVCNPI        60
     EAHRVLSAER RAGYFLPCKL AVYTEDGQTK IGMPRPTSLI GLVEEDELKQ VALDVERQLV       120
     DVIEKSRL                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page