(data stored in ACNUC7421 zone)

EMBL: CP001022.PE353

CP001022.PE353       Location/Qualifiers
FT   CDS             373716..374816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0357"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase A; Methionine sulfoxide reductase B;
FT                   KEGG: vco:VC0395_0557 peptide methionine sulfoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59841"
FT                   /db_xref="GOA:B1YIF8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF8"
FT                   /protein_id="ACB59841.1"
FT                   /translation="MKKRMLTIVSVVALIAIMIGGYFVFQQQQAKSSGSKELTYAKEET
FT                   AILAGGCFWCMEPPFEELKGVKSVISGYTGGDVKNPTYNQVSAETTGHREAVLITFDPA
FT                   VISYKQLLDVYWRQIDPTDPNGQFVDQGESYTTAIFYTNAEQKQIAEQSKKNLAESGIF
FT                   DKKIVTPLIEAGPFYEAEAYHQDYYLKSEKKYKFYRSASERDEFINQYWNDQPKLDVPK
FT                   YSKLTDDQIKAKLTDIQYKVTQEDGTEPAFDNPYHDLKADGIYVDLISGEPLFSSNDKY
FT                   DSKTGWPSFSRPLEKGNIIEKSDFALGMKRMEVRSRHGNAHLGHVFNDGPEPTGLRYCM
FT                   NSAALRFVPKADLEKEGYGQYASEFK"
     MKKRMLTIVS VVALIAIMIG GYFVFQQQQA KSSGSKELTY AKEETAILAG GCFWCMEPPF        60
     EELKGVKSVI SGYTGGDVKN PTYNQVSAET TGHREAVLIT FDPAVISYKQ LLDVYWRQID       120
     PTDPNGQFVD QGESYTTAIF YTNAEQKQIA EQSKKNLAES GIFDKKIVTP LIEAGPFYEA       180
     EAYHQDYYLK SEKKYKFYRS ASERDEFINQ YWNDQPKLDV PKYSKLTDDQ IKAKLTDIQY       240
     KVTQEDGTEP AFDNPYHDLK ADGIYVDLIS GEPLFSSNDK YDSKTGWPSF SRPLEKGNII       300
     EKSDFALGMK RMEVRSRHGN AHLGHVFNDG PEPTGLRYCM NSAALRFVPK ADLEKEGYGQ       360
     YASEFK                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page