(data stored in ACNUC7421 zone)

EMBL: CP001022.PE355

CP001022.PE355       Location/Qualifiers
FT   CDS             378036..380573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0359"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: drm:Dred_1556
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59843"
FT                   /db_xref="GOA:B1YIG0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG0"
FT                   /protein_id="ACB59843.1"
FT                   /translation="MINWIRRRIGRQLLAVFYVLLFLVSMTSFLVYGYMENRIESSRDN
FT                   LEVISEQNRRADHLWDNWQNVQFGLRGFVIFGNQERFDEIQELRTEIKSETDWFTRKAK
FT                   TDEEEEFAAQMTNMYNLYYGALFPLTQSYVNEKKANQINEDFLQGDSLFSLPIAKRLVE
FT                   QGQLKQTADGSIDVEPDIEKASSALNEYRNNLQQQQDTAVANLRSEVAKTKWIWISSIF
FT                   VLIIFILLFVHPFLKRMTKQLLRLIEDNRKLSRNEPIEMDVMERRADEIGMLRSSFNQM
FT                   AVTTGLHKEEMQNKNEELQAQSEELLAQQEELQSQQEELEEAYQATKQNEEKLKMRSEL
FT                   TEALAVRETVESYPAIVQKMLDITSSEYGALLLYDDGVYIGATTNGMKIQQVQSLLDDE
FT                   NSLLNRMRLGTKVVQSEKRVSRTNDTPYSFSTYEVALPIYDPSTHQLMAAVYMVRYQSP
FT                   YQSQQLADMREFSQQMTLSLLRTRSYDEMKQEKQKTEQVLDSIREAIIYLEDGNDELYV
FT                   NRPLFELIPELQSEFTRDRTLSSASYVIEVMRNIVDDVERFNDYLDLIRSGEVSPDKVQ
FT                   FDVRGNSAHLEVYAERIDIEGGWKGVILVIRDITRETEADRLKTELVSTVSHELRTPLS
FT                   SIYGFTELMLNREIDAIKQQKYLSTIHNETERLSNLVTDFLDVQRMQSGGQRYQMAHLD
FT                   LYSIVDQVIGVYKASNGLHDIQLHLLSVERPAIIGDETRIKQLLNNLVNNAIKYSPDGG
FT                   QVDITVSTDQENATIQITDHGIGIPQYAFAHLFDKFYRVDNSDTRRIGGTGLGLSICKE
FT                   IVKEHDGVIHVESTVGKGSTFTVALPLHALENV"
     MINWIRRRIG RQLLAVFYVL LFLVSMTSFL VYGYMENRIE SSRDNLEVIS EQNRRADHLW        60
     DNWQNVQFGL RGFVIFGNQE RFDEIQELRT EIKSETDWFT RKAKTDEEEE FAAQMTNMYN       120
     LYYGALFPLT QSYVNEKKAN QINEDFLQGD SLFSLPIAKR LVEQGQLKQT ADGSIDVEPD       180
     IEKASSALNE YRNNLQQQQD TAVANLRSEV AKTKWIWISS IFVLIIFILL FVHPFLKRMT       240
     KQLLRLIEDN RKLSRNEPIE MDVMERRADE IGMLRSSFNQ MAVTTGLHKE EMQNKNEELQ       300
     AQSEELLAQQ EELQSQQEEL EEAYQATKQN EEKLKMRSEL TEALAVRETV ESYPAIVQKM       360
     LDITSSEYGA LLLYDDGVYI GATTNGMKIQ QVQSLLDDEN SLLNRMRLGT KVVQSEKRVS       420
     RTNDTPYSFS TYEVALPIYD PSTHQLMAAV YMVRYQSPYQ SQQLADMREF SQQMTLSLLR       480
     TRSYDEMKQE KQKTEQVLDS IREAIIYLED GNDELYVNRP LFELIPELQS EFTRDRTLSS       540
     ASYVIEVMRN IVDDVERFND YLDLIRSGEV SPDKVQFDVR GNSAHLEVYA ERIDIEGGWK       600
     GVILVIRDIT RETEADRLKT ELVSTVSHEL RTPLSSIYGF TELMLNREID AIKQQKYLST       660
     IHNETERLSN LVTDFLDVQR MQSGGQRYQM AHLDLYSIVD QVIGVYKASN GLHDIQLHLL       720
     SVERPAIIGD ETRIKQLLNN LVNNAIKYSP DGGQVDITVS TDQENATIQI TDHGIGIPQY       780
     AFAHLFDKFY RVDNSDTRRI GGTGLGLSIC KEIVKEHDGV IHVESTVGKG STFTVALPLH       840
     ALENV                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page