(data stored in ACNUC7421 zone)

EMBL: CP001022.PE361

CP001022.PE361       Location/Qualifiers
FT   CDS             complement(384878..385069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59849"
FT                   /db_xref="GOA:B1YIG6"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG6"
FT                   /protein_id="ACB59849.1"
FT                   /translation="MTVLFWIALVICVLGLIFTVMVGQSRNEETYSNSQTAKNMSWMYL
FT                   VLLPVILIILGIFYYLLT"
     MTVLFWIALV ICVLGLIFTV MVGQSRNEET YSNSQTAKNM SWMYLVLLPV ILIILGIFYY        60
     LLT                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page