(data stored in ACNUC7421 zone)

EMBL: CP001022.PE362

CP001022.PE362       Location/Qualifiers
FT   CDS             385217..385660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0366"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bsu:BSU05640
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59850"
FT                   /db_xref="GOA:B1YIG7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG7"
FT                   /protein_id="ACB59850.1"
FT                   /translation="MKENLREAVQLFEEVMIHGTERVLKSVDSPVWRLYSPEQLHLLKL
FT                   VDKYGPIASGRIAVIQGVHKSAISNRLKKLNEHGLVEVERSEDDHRTKRIILTDAGKEV
FT                   VEASDQAIYSYLEQLIDGKVDDDEIKQFIETFRKVKAILKIED"
     MKENLREAVQ LFEEVMIHGT ERVLKSVDSP VWRLYSPEQL HLLKLVDKYG PIASGRIAVI        60
     QGVHKSAISN RLKKLNEHGL VEVERSEDDH RTKRIILTDA GKEVVEASDQ AIYSYLEQLI       120
     DGKVDDDEIK QFIETFRKVK AILKIED                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page