(data stored in ACNUC7421 zone)

EMBL: CP001022.PE363

CP001022.PE363       Location/Qualifiers
FT   CDS             385696..388365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0367"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bsu:BSU05650
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59851"
FT                   /db_xref="GOA:B1YIG8"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG8"
FT                   /protein_id="ACB59851.1"
FT                   /translation="MRQIVKWRWPIVIVLLLATVGLFLAAPNLSKQAEDAGAIQLASDT
FT                   DSQRAADILKAAGASEETISLVIPLKEAVTKQDRTEIGQIVKDLEKLDQPVTGVLDPFE
FT                   SKETEGQLISKDKKTVLVPITVDGSQEEITALAEDIRSDLLPDDRTIYLTGESLINADV
FT                   NKSSQEGLKRTELITVGLIFGLLLIVFRSIVTPFVPLFAVGVTYLMSQSFVAFFVDWFG
FT                   FPVSNFTQIFLVAILFGIGTDYCILLLSRYKEELTAGHDVETAIVNTYKTAGRTLLISG
FT                   LAVLVGFSAIGFADFPIFKSSVAVAVGIAVLLLVLFTLVPFFMATLKEKLFWPSKNAAS
FT                   HQDSRLWARYGGLSIRRPLLAMAIVAVVTIPTLFTYDDDLSFNTVDEIGAKYETVKGLN
FT                   AISDGFGAGESLPVNIILKDDQNIVTEKTVPYAEQLSRELVKLDGVKAVRSISRPTGEV
FT                   IDDLYVDQQLKQVASGLTDAKDGLGEVGQGLQTVEDNLKTISGQLPAGDQASAGAAQLQ
FT                   QAADGLGQINQQLTLVGQGLQSAENIPQTVGTLTALSGQLTQVQTGIAQAATGIETQGA
FT                   QAGQLGNGLTQLADGVGSANNGLGKIEDGLKEAADFLKEMGNSKTIRGTGMFIPKDTLS
FT                   SKDFEPVIDRYTIDDKTGLKFEVILDDDPYSPEAIETVAAIKKTTASTLKDTPLEQAQV
FT                   AYGGISSINSDLNDTSKADFSRTVVIMIISLFIVLAIMFRSLIMPLFMIGSLLLTYYTS
FT                   VSIAELIFVNGLGYDGISWAVPFFGFVMLVALGIDYSIFLLDRFREETINGLETNEAMY
FT                   VSMKKMGSVIITAAIILAGTFGAMMPSGVLSLVQIATIVITGLLLYGLIVLPLLIPAIT
FT                   VSFGPGVWWPFRQKQNKK"
     MRQIVKWRWP IVIVLLLATV GLFLAAPNLS KQAEDAGAIQ LASDTDSQRA ADILKAAGAS        60
     EETISLVIPL KEAVTKQDRT EIGQIVKDLE KLDQPVTGVL DPFESKETEG QLISKDKKTV       120
     LVPITVDGSQ EEITALAEDI RSDLLPDDRT IYLTGESLIN ADVNKSSQEG LKRTELITVG       180
     LIFGLLLIVF RSIVTPFVPL FAVGVTYLMS QSFVAFFVDW FGFPVSNFTQ IFLVAILFGI       240
     GTDYCILLLS RYKEELTAGH DVETAIVNTY KTAGRTLLIS GLAVLVGFSA IGFADFPIFK       300
     SSVAVAVGIA VLLLVLFTLV PFFMATLKEK LFWPSKNAAS HQDSRLWARY GGLSIRRPLL       360
     AMAIVAVVTI PTLFTYDDDL SFNTVDEIGA KYETVKGLNA ISDGFGAGES LPVNIILKDD       420
     QNIVTEKTVP YAEQLSRELV KLDGVKAVRS ISRPTGEVID DLYVDQQLKQ VASGLTDAKD       480
     GLGEVGQGLQ TVEDNLKTIS GQLPAGDQAS AGAAQLQQAA DGLGQINQQL TLVGQGLQSA       540
     ENIPQTVGTL TALSGQLTQV QTGIAQAATG IETQGAQAGQ LGNGLTQLAD GVGSANNGLG       600
     KIEDGLKEAA DFLKEMGNSK TIRGTGMFIP KDTLSSKDFE PVIDRYTIDD KTGLKFEVIL       660
     DDDPYSPEAI ETVAAIKKTT ASTLKDTPLE QAQVAYGGIS SINSDLNDTS KADFSRTVVI       720
     MIISLFIVLA IMFRSLIMPL FMIGSLLLTY YTSVSIAELI FVNGLGYDGI SWAVPFFGFV       780
     MLVALGIDYS IFLLDRFREE TINGLETNEA MYVSMKKMGS VIITAAIILA GTFGAMMPSG       840
     VLSLVQIATI VITGLLLYGL IVLPLLIPAI TVSFGPGVWW PFRQKQNKK                   889
//

If you have problems or comments...

PBIL Back to PBIL home page