(data stored in ACNUC7421 zone)

EMBL: CP001022.PE365

CP001022.PE365       Location/Qualifiers
FT   CDS             389628..390332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59853"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH0"
FT                   /protein_id="ACB59853.1"
FT                   /translation="MKRIQIADFDRRMPPLELREMDDYYEAVLVSNYDELYPSTQVRTI
FT                   QLADIYVNLVMTSEGAHLVSALFLKPVEVPDIVAWMQLYTIGFATADATGYYVEQADEI
FT                   LEIVLYQGNPIVIATRGTDRLYYETEGAIEMRRESSEVIGKKPLLYLNGEARFEVPHLE
FT                   FNPNQDEIHINGTFLFADYMDTYQGRVGFFRKTDSNLPIVLLVGKAIIEMELTENPDGS
FT                   RILVIEQPYDEA"
     MKRIQIADFD RRMPPLELRE MDDYYEAVLV SNYDELYPST QVRTIQLADI YVNLVMTSEG        60
     AHLVSALFLK PVEVPDIVAW MQLYTIGFAT ADATGYYVEQ ADEILEIVLY QGNPIVIATR       120
     GTDRLYYETE GAIEMRRESS EVIGKKPLLY LNGEARFEVP HLEFNPNQDE IHINGTFLFA       180
     DYMDTYQGRV GFFRKTDSNL PIVLLVGKAI IEMELTENPD GSRILVIEQP YDEA             234
//

If you have problems or comments...

PBIL Back to PBIL home page