(data stored in ACNUC7421 zone)

EMBL: CP001022.PE366

CP001022.PE366       Location/Qualifiers
FT   CDS             390466..391626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0370"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bha:BH1094
FT                   transcriptional repressor of the xylose operon"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59854"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH1"
FT                   /protein_id="ACB59854.1"
FT                   /translation="MVKEMPRNSKWMRSYNRALVLRLIRMHQPISRVELAQQTKLTKPT
FT                   VSNIVGELIADQLVMERELGVSNGGRKPILLELVAKEQYVIGIDATSHRFIGVIADLSG
FT                   NTIHEVETMGKFDTNEELMEAVVQLCQQLIDATDQVGTIHGIGISVHGMVNPETGVILF
FT                   APRFHLHDVALKEHLEQRFAYPVFIENDVRALASFELLFGEGVGVDQFFYLYAGEGIGG
FT                   AYVLDGKLIDGENHITGEVGHMRLDLDGPICSCGNRGCLEALAGEKALLRDFEAVDPQV
FT                   KTLTELRRRLTDQDPHATAAYHRAGEYIGIGVLNTIHLINPKRILLGGPMFELAPSIVD
FT                   QIKERVEHTALTTASRETDVKMVPWSEKQGALSAAALATNSIFQTI"
     MVKEMPRNSK WMRSYNRALV LRLIRMHQPI SRVELAQQTK LTKPTVSNIV GELIADQLVM        60
     ERELGVSNGG RKPILLELVA KEQYVIGIDA TSHRFIGVIA DLSGNTIHEV ETMGKFDTNE       120
     ELMEAVVQLC QQLIDATDQV GTIHGIGISV HGMVNPETGV ILFAPRFHLH DVALKEHLEQ       180
     RFAYPVFIEN DVRALASFEL LFGEGVGVDQ FFYLYAGEGI GGAYVLDGKL IDGENHITGE       240
     VGHMRLDLDG PICSCGNRGC LEALAGEKAL LRDFEAVDPQ VKTLTELRRR LTDQDPHATA       300
     AYHRAGEYIG IGVLNTIHLI NPKRILLGGP MFELAPSIVD QIKERVEHTA LTTASRETDV       360
     KMVPWSEKQG ALSAAALATN SIFQTI                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page