(data stored in ACNUC7421 zone)

EMBL: CP001022.PE369

CP001022.PE369       Location/Qualifiers
FT   CDS             393760..394725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0373"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU32590 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59857"
FT                   /db_xref="GOA:B1YIH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH4"
FT                   /protein_id="ACB59857.1"
FT                   /translation="MQTEQQELPIKPKAETLKAAPRPNVPKQKKKGKMKQNMVGWAFVG
FT                   PIVLFVVAFIYYGIFYNAYNSFFSWDGISFDKVFVGFENYAEMFRDPDFYLSLKNTFIF
FT                   TILTVTIQAFIGLVLAYFLHTQGPLRTAMKSVFFFPVVLSPVVLGAAFSQIYDFQFGYI
FT                   NEFLRAIGLGSLEQNWLGDPDIALYSVIAINIFQWTGSSMVMYYMAMLTIEKEIFEAAK
FT                   IDGAGFFRTLWSIVFPNLKGTTFTLSILGVIGGLKTFDLVWITTAGGPGSSTEFISTYL
FT                   FRKSMLQQEVGFSSAVAIILLTIALLITYFQLRVQKKMDN"
     MQTEQQELPI KPKAETLKAA PRPNVPKQKK KGKMKQNMVG WAFVGPIVLF VVAFIYYGIF        60
     YNAYNSFFSW DGISFDKVFV GFENYAEMFR DPDFYLSLKN TFIFTILTVT IQAFIGLVLA       120
     YFLHTQGPLR TAMKSVFFFP VVLSPVVLGA AFSQIYDFQF GYINEFLRAI GLGSLEQNWL       180
     GDPDIALYSV IAINIFQWTG SSMVMYYMAM LTIEKEIFEA AKIDGAGFFR TLWSIVFPNL       240
     KGTTFTLSIL GVIGGLKTFD LVWITTAGGP GSSTEFISTY LFRKSMLQQE VGFSSAVAII       300
     LLTIALLITY FQLRVQKKMD N                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page