(data stored in ACNUC7421 zone)

EMBL: CP001022.PE371

CP001022.PE371       Location/Qualifiers
FT   CDS             395550..397544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0375"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: lic:LIC10031
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59859"
FT                   /db_xref="GOA:B1YIH6"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH6"
FT                   /protein_id="ACB59859.1"
FT                   /translation="MYLGVDYYPEQTPRALWEEDFRLMKELGVNVVRLAEFAWTMMEPE
FT                   EGVYDFRFWDDIIERLSAAGFDIVLGTPTATPPAWMCHKYPEILPADEHGVTISFGARR
FT                   HYTVHSETYQRFSVAITTEMAKRYGKHSRVIGWQTDNEYGHEKSDRSYSDVDRAAFQVW
FT                   LKNRYGTLDALNETWGTVFWSQIYTAWEQIPVPRKVYQEHNPSLLVDFDRFCADGYNHY
FT                   NKLQVDALREHIHPEAFITHNLVYSDMAVNQQQMAQDLDYVAFDNYPVWGGLPEPNRFE
FT                   KMASDHDLCRSSKQGKGFWVMEQLSGAQGWSKIGYLPRPGHIRLWTYQAVARGAEAIVY
FT                   FRFRAALFGTEEFCHGIIDHDGKPKRKFNEVKQIMTELNTFGDEINASSYRAEVGVYFD
FT                   QENVWAWTHQPHSDAFDFRTEFVRFYGGAVRRQASTDIVFPGDKLDQYKLIIVPLYFLT
FT                   NPTFDQALIDYMEQGGHVIFTYRTGVKDPHNNVLPLTLPGQFATYAGIEIDEYESLQAV
FT                   QENRVEGIGKFAGQGSPARLWCDLITPTTAEPLAVYRDTFYDGVAAVTRNEYKGMITYI
FT                   GASIDDAMIDTIYRQAFLDAGVQTFEAPDQVEIVRRHGETRDFLFLMNHDTKASRDVVL
FT                   DAAYQELNTNETYSGTVTLAPLETLILTT"
     MYLGVDYYPE QTPRALWEED FRLMKELGVN VVRLAEFAWT MMEPEEGVYD FRFWDDIIER        60
     LSAAGFDIVL GTPTATPPAW MCHKYPEILP ADEHGVTISF GARRHYTVHS ETYQRFSVAI       120
     TTEMAKRYGK HSRVIGWQTD NEYGHEKSDR SYSDVDRAAF QVWLKNRYGT LDALNETWGT       180
     VFWSQIYTAW EQIPVPRKVY QEHNPSLLVD FDRFCADGYN HYNKLQVDAL REHIHPEAFI       240
     THNLVYSDMA VNQQQMAQDL DYVAFDNYPV WGGLPEPNRF EKMASDHDLC RSSKQGKGFW       300
     VMEQLSGAQG WSKIGYLPRP GHIRLWTYQA VARGAEAIVY FRFRAALFGT EEFCHGIIDH       360
     DGKPKRKFNE VKQIMTELNT FGDEINASSY RAEVGVYFDQ ENVWAWTHQP HSDAFDFRTE       420
     FVRFYGGAVR RQASTDIVFP GDKLDQYKLI IVPLYFLTNP TFDQALIDYM EQGGHVIFTY       480
     RTGVKDPHNN VLPLTLPGQF ATYAGIEIDE YESLQAVQEN RVEGIGKFAG QGSPARLWCD       540
     LITPTTAEPL AVYRDTFYDG VAAVTRNEYK GMITYIGASI DDAMIDTIYR QAFLDAGVQT       600
     FEAPDQVEIV RRHGETRDFL FLMNHDTKAS RDVVLDAAYQ ELNTNETYSG TVTLAPLETL       660
     ILTT                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page