(data stored in ACNUC7421 zone)

EMBL: CP001022.PE381

CP001022.PE381       Location/Qualifiers
FT   CDS             complement(409051..410103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0385"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: gtn:GTNG_1912 pyruvate decarboxylase alpha
FT                   subunit-like protein; TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59869"
FT                   /db_xref="GOA:B1YII6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII6"
FT                   /protein_id="ACB59869.1"
FT                   /translation="METEFPIYRILDDAGQVTDTSKTDLLTKDLSLALFTHMNRIRTFD
FT                   RKAINLQRQGRLGTYAPFEGQEAAQVGSAYALQDKDWVFPTYRDHGATLTFGADMVRTF
FT                   LYWNGRVEGCVATDELHIFPPAVPIATQIPHAVGAAWAEKRKGSTQVAVAYFGDGATSE
FT                   GDFHEGMNFASVFQAPVILFNQNNGYAISVPIQKQMHSETIAQKALAYGMPSVRIDGND
FT                   VFAVYFTMQKALERARSGGGPTLIEAVTWRFGAHTTADDPSKYRDQERSRDRVDPLERL
FT                   EAFMKEQGFYDEQEIETIRSRHQEEVEAAVKTMESFPPPDVNDLFDHTFATLPDDLVRQ
FT                   KTDYLTARGN"
     METEFPIYRI LDDAGQVTDT SKTDLLTKDL SLALFTHMNR IRTFDRKAIN LQRQGRLGTY        60
     APFEGQEAAQ VGSAYALQDK DWVFPTYRDH GATLTFGADM VRTFLYWNGR VEGCVATDEL       120
     HIFPPAVPIA TQIPHAVGAA WAEKRKGSTQ VAVAYFGDGA TSEGDFHEGM NFASVFQAPV       180
     ILFNQNNGYA ISVPIQKQMH SETIAQKALA YGMPSVRIDG NDVFAVYFTM QKALERARSG       240
     GGPTLIEAVT WRFGAHTTAD DPSKYRDQER SRDRVDPLER LEAFMKEQGF YDEQEIETIR       300
     SRHQEEVEAA VKTMESFPPP DVNDLFDHTF ATLPDDLVRQ KTDYLTARGN                  350
//

If you have problems or comments...

PBIL Back to PBIL home page