(data stored in ACNUC7421 zone)

EMBL: CP001022.PE392

CP001022.PE392       Location/Qualifiers
FT   CDS             418627..419499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0396"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   gka:GK2036 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59880"
FT                   /db_xref="GOA:B1YIJ7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ7"
FT                   /protein_id="ACB59880.1"
FT                   /translation="MMVQQMVVVGSGVMGRGIAYVAAASGFDVTLVDVEQQLLASAQQE
FT                   LETIADKGVSRGKMTTEEVGQLFDRLRYATDLEEAVKEADLVIEAVPERLEIKRMVFET
FT                   LDRHAPAECVFATNTSTMSPTEIASFTKRPERVMAMHFFNPVHRMPLVELARGLETSDE
FT                   TVMICETVAQQMGKETVVIQEFPGFVTSRISALVGNEAFYMLQEGLGTPEEIDKAIKLG
FT                   LNYPMGPFELGDLVGLDTRLNNLKYLHEKLGEKYRPAPLLEQYVKAGRLGRKTGRGVYE
FT                   YSDSGVKTR"
     MMVQQMVVVG SGVMGRGIAY VAAASGFDVT LVDVEQQLLA SAQQELETIA DKGVSRGKMT        60
     TEEVGQLFDR LRYATDLEEA VKEADLVIEA VPERLEIKRM VFETLDRHAP AECVFATNTS       120
     TMSPTEIASF TKRPERVMAM HFFNPVHRMP LVELARGLET SDETVMICET VAQQMGKETV       180
     VIQEFPGFVT SRISALVGNE AFYMLQEGLG TPEEIDKAIK LGLNYPMGPF ELGDLVGLDT       240
     RLNNLKYLHE KLGEKYRPAP LLEQYVKAGR LGRKTGRGVY EYSDSGVKTR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page