(data stored in ACNUC7421 zone)

EMBL: CP001022.PE395

CP001022.PE395       Location/Qualifiers
FT   CDS             421548..422432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0399"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="TIGRFAM: phenylacetic acid degradation operon
FT                   negative regulatory protein PaaX; PFAM: PaaX domain
FT                   protein; PaaX domain protein domain; KEGG: gka:GK2034
FT                   repressor in the phenylacetic acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59883"
FT                   /db_xref="GOA:B1YIK0"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK0"
FT                   /protein_id="ACB59883.1"
FT                   /translation="MSANTQSMIFTVYGDYIRHYGNQIWVGSLIRLLKEFGHNEQAVRV
FT                   AVSRMVKQGWLTSQKQGTKSFYSLTPRGVERMEEAARRIYKSTPHVWDGKWRTLMYTIP
FT                   EDKRQIRDELRKELSWSGFGNLSNGVWISPNPLEKEAERLIEAYDIKAYIDFFVGEYHG
FT                   PQQDQSLVERAFPLDELQERYEQFIAEYSRRYIVHQSRIQLGEMDEEQCFVERTTLVHE
FT                   YRKFLFTDPGLPQELLPDEWSGHHAALLFEQYYRLLAEPASRFFESIFRETHDVTQKSA
FT                   DYDASEHPLFAER"
     MSANTQSMIF TVYGDYIRHY GNQIWVGSLI RLLKEFGHNE QAVRVAVSRM VKQGWLTSQK        60
     QGTKSFYSLT PRGVERMEEA ARRIYKSTPH VWDGKWRTLM YTIPEDKRQI RDELRKELSW       120
     SGFGNLSNGV WISPNPLEKE AERLIEAYDI KAYIDFFVGE YHGPQQDQSL VERAFPLDEL       180
     QERYEQFIAE YSRRYIVHQS RIQLGEMDEE QCFVERTTLV HEYRKFLFTD PGLPQELLPD       240
     EWSGHHAALL FEQYYRLLAE PASRFFESIF RETHDVTQKS ADYDASEHPL FAER             294
//

If you have problems or comments...

PBIL Back to PBIL home page