(data stored in ACNUC7421 zone)

EMBL: CP001022.PE4

CP001022.PE4         Location/Qualifiers
FT   CDS             3506..4660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59492"
FT                   /db_xref="GOA:B1YGB5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGB5"
FT                   /protein_id="ACB59492.1"
FT                   /translation="MRLDSVRLSHYRNYESLELSFSEKTNVLIGENAQGKTNLLEAIYV
FT                   LALAKSHRTTHDKELIQWDAETARVEGRIHKRRGSHSQEIAISSRGKKAKLNHLEQRRL
FT                   SDYVGALNIVLFAPEDLHIVKGSPQIRRRFLDMEIGQVSPVYLHELSQYLKVLKQRNAL
FT                   LKQLSMKGGDETFLDVLTEQMITLAVKIVQRRHHFIAQLEKWARPIHEGISRGQEQLVL
FT                   IYRSDTFSNDLLDVEGMTASYMQKFGKMKTNEIRRGVTLFGPHRDDFEMEVNGRNVQTY
FT                   GSQGQQRTAALSLKLAEIELIHEEVGEYPLLLLDDVLSELDDHRQTHLLDTMQQKVQTI
FT                   LTTTSVDGIAHETIKQAKLFHVKQGAVILEETSYKEIVGEKTDE"
     MRLDSVRLSH YRNYESLELS FSEKTNVLIG ENAQGKTNLL EAIYVLALAK SHRTTHDKEL        60
     IQWDAETARV EGRIHKRRGS HSQEIAISSR GKKAKLNHLE QRRLSDYVGA LNIVLFAPED       120
     LHIVKGSPQI RRRFLDMEIG QVSPVYLHEL SQYLKVLKQR NALLKQLSMK GGDETFLDVL       180
     TEQMITLAVK IVQRRHHFIA QLEKWARPIH EGISRGQEQL VLIYRSDTFS NDLLDVEGMT       240
     ASYMQKFGKM KTNEIRRGVT LFGPHRDDFE MEVNGRNVQT YGSQGQQRTA ALSLKLAEIE       300
     LIHEEVGEYP LLLLDDVLSE LDDHRQTHLL DTMQQKVQTI LTTTSVDGIA HETIKQAKLF       360
     HVKQGAVILE ETSYKEIVGE KTDE                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page