(data stored in ACNUC7421 zone)

EMBL: CP001022.PE40

CP001022.PE40        Location/Qualifiers
FT   CDS             56312..57661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0041"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: bcy:Bcer98_0044
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59528"
FT                   /db_xref="GOA:B1YGP5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGP5"
FT                   /protein_id="ACB59528.1"
FT                   /translation="MNHFAVILAAGKGTRMKSKLYKVLHPVAGKPMVQHVVDQLTTLGV
FT                   TRQVVIVGHGAESVKEVLGTSVEYALQSEQLGTGHAVQMAEPVLGQEKGSTLVVCGDTP
FT                   LLTSETLQSLLQHHAETGAKVTVLTAHADDATGYGRIVRGEDGNVSKIVEHKDANAEEL
FT                   LIKEINTGTYVFDNEMLFEALKQVKNDNVQGEYYLPDVIEIAKADGETIAAYAASTFEE
FT                   TIGVNDRVALAQAETSMRKRTNEHWMRQGVTFIDPASTYIGPDVVIGSDTVLYPGTQLL
FT                   GNTTIGSECIIGPNSDIRNSEVADQAVVRQSVVTDSKIGPAAQVGPFAHLRQQAVLGAN
FT                   TRIGNFVEVKKSTFGEGSKSAHLSYVGDATIGTNVNLGCGSITVNYDGTNKFQTVIEDD
FT                   AFIGCNVNLIAPVTVGKNALVAAGSTVTDDVPENGLAIARERQTTKPDYR"
     MNHFAVILAA GKGTRMKSKL YKVLHPVAGK PMVQHVVDQL TTLGVTRQVV IVGHGAESVK        60
     EVLGTSVEYA LQSEQLGTGH AVQMAEPVLG QEKGSTLVVC GDTPLLTSET LQSLLQHHAE       120
     TGAKVTVLTA HADDATGYGR IVRGEDGNVS KIVEHKDANA EELLIKEINT GTYVFDNEML       180
     FEALKQVKND NVQGEYYLPD VIEIAKADGE TIAAYAASTF EETIGVNDRV ALAQAETSMR       240
     KRTNEHWMRQ GVTFIDPAST YIGPDVVIGS DTVLYPGTQL LGNTTIGSEC IIGPNSDIRN       300
     SEVADQAVVR QSVVTDSKIG PAAQVGPFAH LRQQAVLGAN TRIGNFVEVK KSTFGEGSKS       360
     AHLSYVGDAT IGTNVNLGCG SITVNYDGTN KFQTVIEDDA FIGCNVNLIA PVTVGKNALV       420
     AAGSTVTDDV PENGLAIARE RQTTKPDYR                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page