(data stored in ACNUC7421 zone)

EMBL: CP001022.PE400

CP001022.PE400       Location/Qualifiers
FT   CDS             complement(425162..425692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0404"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: gka:GK2710
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59888"
FT                   /db_xref="GOA:B1YIK5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK5"
FT                   /protein_id="ACB59888.1"
FT                   /translation="MEKATFAGGCFWCMVTPFEELPGIHSIVSGYTGGHVDNPTYEQVK
FT                   TGTTGHSEVVEITFDPALFSYERLLELYWPQTDPTDAGGQFQDRGTQYAPAIFYHTEEQ
FT                   RLAAIASRDALAATNRFKQPIVTRIEPAHAFYPAEEYHQDFHKKNPAHYKKDRKASGRD
FT                   AFIDVAWKEEVTV"
     MEKATFAGGC FWCMVTPFEE LPGIHSIVSG YTGGHVDNPT YEQVKTGTTG HSEVVEITFD        60
     PALFSYERLL ELYWPQTDPT DAGGQFQDRG TQYAPAIFYH TEEQRLAAIA SRDALAATNR       120
     FKQPIVTRIE PAHAFYPAEE YHQDFHKKNP AHYKKDRKAS GRDAFIDVAW KEEVTV           176
//

If you have problems or comments...

PBIL Back to PBIL home page