(data stored in ACNUC7421 zone)

EMBL: CP001022.PE402

CP001022.PE402       Location/Qualifiers
FT   CDS             complement(427571..430000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0408"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; SMART: SH3 domain protein;
FT                   KEGG: oih:OB2902 peptidoglycan hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59890"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK7"
FT                   /protein_id="ACB59890.1"
FT                   /translation="MATGKQFTQTATPVFETTESTAAVSTLPAATEVETFGVEGLFTRI
FT                   LLDGVYRFVKTDQLADTPTYPKIDSHYTNKVTALYSSADSSAATAQTFAPNSKIDTYGQ
FT                   VGLFTRVKQDADYLFVLTADLSTTPVYSATGERFVQQKTSVYPTADTVGTPLTTLKQND
FT                   SIKTFGTSGNVTRIEWNGTYAFVLTAHLGTKPVVSYEATGKKYSQQTANVYPTAATTGT
FT                   PLGILSQNQLVDIYGVSGAYTRVRLNGVYGFVLTAQLGNLEFFAQTARLYVQSPTPIRQ
FT                   APNASSPVLKEHQTNTLLTVYGTSGTYSRILFNGQYAYVLTSALAPLKVYAKTARLYVQ
FT                   TPTAIRSAPNASSPVLKQHQMNTLLTVYGTSGAYSRILFREQYAYVLTSTLAPTKVYAK
FT                   TGLRYASKSTAIFKDTTAKTIVRTMKRAEQIDIYGTSGSYTRVKLGSVYAYVKTADLVT
FT                   KKPDLYDVTGIRYVLDDKVVVHPKASLTGKIGTLKKNAQLSIYGTSGYYTRVKIGTTFG
FT                   FVDSSRLGLNKPVARPKVGTVFYVHFDQTPLFSADVAYSRPAGYLSKGTKLIGLKAIDD
FT                   DFWQVRLPNGTTGYVINPYIGTTKPDMRYTQQAINRQKIYTVKATSSYFATPVSPKSAG
FT                   LVEQGKRVYPRYRVGNFYVIQSGWSPVYLPVSAVTVKTDTRIAQKNTSRGEKLIQAAAK
FT                   HLGTPYTWGSQTAANGGFDCSGLIHYATNEAGKYGGRTNVSGYWYGAFFTNRRTTISSG
FT                   KRSDIVFFENTYTDGPSHIGIMLDNEYFIHAGGSQLQINSIYEPRWQEHFLGFKSM"
     MATGKQFTQT ATPVFETTES TAAVSTLPAA TEVETFGVEG LFTRILLDGV YRFVKTDQLA        60
     DTPTYPKIDS HYTNKVTALY SSADSSAATA QTFAPNSKID TYGQVGLFTR VKQDADYLFV       120
     LTADLSTTPV YSATGERFVQ QKTSVYPTAD TVGTPLTTLK QNDSIKTFGT SGNVTRIEWN       180
     GTYAFVLTAH LGTKPVVSYE ATGKKYSQQT ANVYPTAATT GTPLGILSQN QLVDIYGVSG       240
     AYTRVRLNGV YGFVLTAQLG NLEFFAQTAR LYVQSPTPIR QAPNASSPVL KEHQTNTLLT       300
     VYGTSGTYSR ILFNGQYAYV LTSALAPLKV YAKTARLYVQ TPTAIRSAPN ASSPVLKQHQ       360
     MNTLLTVYGT SGAYSRILFR EQYAYVLTST LAPTKVYAKT GLRYASKSTA IFKDTTAKTI       420
     VRTMKRAEQI DIYGTSGSYT RVKLGSVYAY VKTADLVTKK PDLYDVTGIR YVLDDKVVVH       480
     PKASLTGKIG TLKKNAQLSI YGTSGYYTRV KIGTTFGFVD SSRLGLNKPV ARPKVGTVFY       540
     VHFDQTPLFS ADVAYSRPAG YLSKGTKLIG LKAIDDDFWQ VRLPNGTTGY VINPYIGTTK       600
     PDMRYTQQAI NRQKIYTVKA TSSYFATPVS PKSAGLVEQG KRVYPRYRVG NFYVIQSGWS       660
     PVYLPVSAVT VKTDTRIAQK NTSRGEKLIQ AAAKHLGTPY TWGSQTAANG GFDCSGLIHY       720
     ATNEAGKYGG RTNVSGYWYG AFFTNRRTTI SSGKRSDIVF FENTYTDGPS HIGIMLDNEY       780
     FIHAGGSQLQ INSIYEPRWQ EHFLGFKSM                                         809
//

If you have problems or comments...

PBIL Back to PBIL home page