(data stored in ACNUC7421 zone)

EMBL: CP001022.PE404

CP001022.PE404       Location/Qualifiers
FT   CDS             431125..431454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0410"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   bha:BH0686 chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59892"
FT                   /db_xref="GOA:B1YIK9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK9"
FT                   /protein_id="ACB59892.1"
FT                   /translation="MAKYWLSIILASFFEVGWVIGLKHATTPLEWAATVVSIIISFTVL
FT                   IKVCNHLPVGTVYAVFVGLGTAGTVVTDIVLFDQSASVIKLILIAVLLVGVIGLKLVSG
FT                   EGEKQ"
     MAKYWLSIIL ASFFEVGWVI GLKHATTPLE WAATVVSIII SFTVLIKVCN HLPVGTVYAV        60
     FVGLGTAGTV VTDIVLFDQS ASVIKLILIA VLLVGVIGLK LVSGEGEKQ                   109
//

If you have problems or comments...

PBIL Back to PBIL home page