(data stored in ACNUC7421 zone)

EMBL: CP001022.PE405

CP001022.PE405       Location/Qualifiers
FT   CDS             431451..431768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0411"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   bpu:BPUM_1203 DMT superfamily drug/metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59893"
FT                   /db_xref="GOA:B1YIL0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL0"
FT                   /protein_id="ACB59893.1"
FT                   /translation="MSWFYLILAGLFEMLGVVLINTYNQQKNVKNLLLMFAGFGFSFLF
FT                   LTLAMNELPMGTAYAVWTGIGAAGGTILSMIFYNEAKDWKRIVCIGLILSATIGLKLAG
FT                   E"
     MSWFYLILAG LFEMLGVVLI NTYNQQKNVK NLLLMFAGFG FSFLFLTLAM NELPMGTAYA        60
     VWTGIGAAGG TILSMIFYNE AKDWKRIVCI GLILSATIGL KLAGE                       105
//

If you have problems or comments...

PBIL Back to PBIL home page