(data stored in ACNUC7421 zone)

EMBL: CP001022.PE406

CP001022.PE406       Location/Qualifiers
FT   CDS             431886..432647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:571801 hypothetical LOC571801"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59894"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL1"
FT                   /protein_id="ACB59894.1"
FT                   /translation="MDMKTKQYIGTFYKEEELISKMDELHQQGHREEDFYIIVKEKSNL
FT                   QLVRSQMDAEIATTKPSWIDRIRGNQGRDQEVNDLFGSLDLPADQVEVHKTEVEGGGFV
FT                   LLLEVQDIQFDPHLNTDNTHPDVKVRYGSYEETHTSDDANSNAQLGSGNPLDVDKDSKE
FT                   EHAEIDLHRAGTDKMPQDEEAIHHAKLKEDRKPDIAMRRDDDFKRPEWEEQKVRHEEQQ
FT                   DGKKDDIHRPNRSADHSDDLAKQDHGNDLDR"
     MDMKTKQYIG TFYKEEELIS KMDELHQQGH REEDFYIIVK EKSNLQLVRS QMDAEIATTK        60
     PSWIDRIRGN QGRDQEVNDL FGSLDLPADQ VEVHKTEVEG GGFVLLLEVQ DIQFDPHLNT       120
     DNTHPDVKVR YGSYEETHTS DDANSNAQLG SGNPLDVDKD SKEEHAEIDL HRAGTDKMPQ       180
     DEEAIHHAKL KEDRKPDIAM RRDDDFKRPE WEEQKVRHEE QQDGKKDDIH RPNRSADHSD       240
     DLAKQDHGND LDR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page