(data stored in ACNUC7421 zone)

EMBL: CP001022.PE409

CP001022.PE409       Location/Qualifiers
FT   CDS             complement(434764..435726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0415"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: aeh:Mlg_2042
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59897"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL4"
FT                   /protein_id="ACB59897.1"
FT                   /translation="MWHPCAECTTTIRFIEAGSLHIQSPTPEVFSYSSFEQLEQILSST
FT                   LQIGDFPVSCRAKGSRLVTPVLAASVLLEQLKSRQAIDFIQNGVMTSHLQPIFNIQDNS
FT                   LFANEALLRAADQTIPMSPGLLFSTASKMGLHSRLDQRAREEAIRATHLVGGTQKTFIN
FT                   FLPSTIYNPEYCLRHTFEIVERYNVDPSRLVFEVVETEKIEDVNHLKHVFEQYKKQGIQ
FT                   VALDDVGAGFSTLDMLSLLQPDYVKIDRAFISNCDTVAENEAFLRKARHLTKEMGIQIL
FT                   AEGIERQEELELCRELGFDFGQGYLLGHPAPYSELAKAQ"
     MWHPCAECTT TIRFIEAGSL HIQSPTPEVF SYSSFEQLEQ ILSSTLQIGD FPVSCRAKGS        60
     RLVTPVLAAS VLLEQLKSRQ AIDFIQNGVM TSHLQPIFNI QDNSLFANEA LLRAADQTIP       120
     MSPGLLFSTA SKMGLHSRLD QRAREEAIRA THLVGGTQKT FINFLPSTIY NPEYCLRHTF       180
     EIVERYNVDP SRLVFEVVET EKIEDVNHLK HVFEQYKKQG IQVALDDVGA GFSTLDMLSL       240
     LQPDYVKIDR AFISNCDTVA ENEAFLRKAR HLTKEMGIQI LAEGIERQEE LELCRELGFD       300
     FGQGYLLGHP APYSELAKAQ                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page