(data stored in ACNUC7421 zone)

EMBL: CP001022.PE413

CP001022.PE413       Location/Qualifiers
FT   CDS             complement(437659..438495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0419"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: gka:GK0218 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59901"
FT                   /db_xref="GOA:B1YIX1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIX1"
FT                   /protein_id="ACB59901.1"
FT                   /translation="MTIIELLKALLLGFIEGMTEFAPVSSTGHMIIVDDMWLQTTDFLG
FT                   KYSANTFKIVIQLGSILAVIVVFWKRLFSLIGLYKIEGEHDASGTHKLKLRHVLIGLLP
FT                   AAVLGLLFEDFIDENLFSIDTVIIGLAAGAILMIAADKLGPKEPKTTSLDQISYRQAAL
FT                   VGLFQCISLWPGFSRSGSTISGGVFLGMNHRTAADFTFIMAVPIMFGASALSLVKNWEY
FT                   INVGDLGFYVVGFIASFGFALLSIRFFLKLINKIKLVPFAIYRLVLAAVLAVIVYM"
     MTIIELLKAL LLGFIEGMTE FAPVSSTGHM IIVDDMWLQT TDFLGKYSAN TFKIVIQLGS        60
     ILAVIVVFWK RLFSLIGLYK IEGEHDASGT HKLKLRHVLI GLLPAAVLGL LFEDFIDENL       120
     FSIDTVIIGL AAGAILMIAA DKLGPKEPKT TSLDQISYRQ AALVGLFQCI SLWPGFSRSG       180
     STISGGVFLG MNHRTAADFT FIMAVPIMFG ASALSLVKNW EYINVGDLGF YVVGFIASFG       240
     FALLSIRFFL KLINKIKLVP FAIYRLVLAA VLAVIVYM                               278
//

If you have problems or comments...

PBIL Back to PBIL home page