(data stored in ACNUC7421 zone)

EMBL: CP001022.PE414

CP001022.PE414       Location/Qualifiers
FT   CDS             438667..440790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0420"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bca:BCE_0663 heavy metal-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59902"
FT                   /db_xref="GOA:B1YIX2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX2"
FT                   /protein_id="ACB59902.1"
FT                   /translation="MEAKTERLKITGIDCANCAAKVERGVASVAGIEQADLDFAGQKLY
FT                   LTYEKGAASDDTYQAVVERIQQLEPDVHLVRTASTEAVDPREHAGHDHSHPHDHGPFLN
FT                   RTKKIQYSVGMISFISAFFVPGSIDLLFFAVAYFLIGWDVLQTAVRNIRHGQVFDENFL
FT                   MVIATVGAFLIGEYPEAVAVMLFYQVGEFFQHRAVDQSRKSIAALMDIRPDIATLEDGR
FT                   RVSPEQVNIGQRIVVRAGEKIPLDGTVLTGEAFIDTTALTGESVPRRVRPTEPVLAGTI
FT                   NTDGHLLIQVDRPYNESTVAKILDLVENASRHKAPTEKFITRFARVYTPIVVLVATLLA
FT                   VVPPLVVTGATWSDWIYRALVFLVISCPCALVISIPLGFFSGIGAASKRGILVKGGNHL
FT                   EALQQLDTVVFDKTGTLTEGVFEVVELKAVHGSEDELLRVAATVEQHSNHPIAKSIQRM
FT                   YARHASVSTAVQDYQEVAGSGVTGRFGTDQIQAGNARWFKELGLTPLDQTEDGTYVHVA
FT                   QNDSYLGFIRIADRIKDTTVEALDGLKALGIRQTIMLTGDRRETAEQIGRQIGITQVKA
FT                   ELLPDQKVEQLEAILYQANGRVAFVGDGINDAPVLTRADVGIAMGGLGSDVAIEAADVV
FT                   LMTDEPKQLVEAIRIARATRRIVYQNIAFALGIKGVFLLLGAFGVATMWEAVFADVGVT
FT                   VLAVLNAMRILRK"
     MEAKTERLKI TGIDCANCAA KVERGVASVA GIEQADLDFA GQKLYLTYEK GAASDDTYQA        60
     VVERIQQLEP DVHLVRTAST EAVDPREHAG HDHSHPHDHG PFLNRTKKIQ YSVGMISFIS       120
     AFFVPGSIDL LFFAVAYFLI GWDVLQTAVR NIRHGQVFDE NFLMVIATVG AFLIGEYPEA       180
     VAVMLFYQVG EFFQHRAVDQ SRKSIAALMD IRPDIATLED GRRVSPEQVN IGQRIVVRAG       240
     EKIPLDGTVL TGEAFIDTTA LTGESVPRRV RPTEPVLAGT INTDGHLLIQ VDRPYNESTV       300
     AKILDLVENA SRHKAPTEKF ITRFARVYTP IVVLVATLLA VVPPLVVTGA TWSDWIYRAL       360
     VFLVISCPCA LVISIPLGFF SGIGAASKRG ILVKGGNHLE ALQQLDTVVF DKTGTLTEGV       420
     FEVVELKAVH GSEDELLRVA ATVEQHSNHP IAKSIQRMYA RHASVSTAVQ DYQEVAGSGV       480
     TGRFGTDQIQ AGNARWFKEL GLTPLDQTED GTYVHVAQND SYLGFIRIAD RIKDTTVEAL       540
     DGLKALGIRQ TIMLTGDRRE TAEQIGRQIG ITQVKAELLP DQKVEQLEAI LYQANGRVAF       600
     VGDGINDAPV LTRADVGIAM GGLGSDVAIE AADVVLMTDE PKQLVEAIRI ARATRRIVYQ       660
     NIAFALGIKG VFLLLGAFGV ATMWEAVFAD VGVTVLAVLN AMRILRK                     707
//

If you have problems or comments...

PBIL Back to PBIL home page