(data stored in ACNUC7421 zone)

EMBL: CP001022.PE417

CP001022.PE417       Location/Qualifiers
FT   CDS             complement(442049..443374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0423"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   gtn:GTNG_2069 DNA-damage repair protein, ImpB/MucB/SamB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59905"
FT                   /db_xref="GOA:B1YIX5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX5"
FT                   /protein_id="ACB59905.1"
FT                   /translation="MNPILPFPDRRIFCVDSVSFYASCECRYRNLPPLTTKLAVVSDLT
FT                   RSGSVILAASPALKQLGIKTASRLYQIEQLPYRERKQIVLVEPRMLAYMKTSIEVLDVL
FT                   HQFAPPDAIRIYSIDENFVDMSGTERLFGSDTETAWKIQTAIWQQTGIPVRIGIGPNNV
FT                   IAKLVLDLRGKREGIAQCGYADVSRLLHDFPVRKMWGVGRMMEQHLSVMGIHTIGDLAA
FT                   APVEDLHERFGVIGAELWHHAWGIDGSPTIIDPMTLFRTAPDTKRTIGHGVTLMRDYYQ
FT                   YEQIRLVLAELASDVAARVRFSNQVGWTVHLGVRYSRHVARDGFSKQLRLPYPTADERL
FT                   LLRHILQLFEPNWLDGEPVRFLSVALGQLTPDQGTLQLSLFEDNTKVWRRKRLLKAIDH
FT                   VNLRYGKGTIRLAVSFLDTSVAKRRLRFVGGHPGGDLHDTLS"
     MNPILPFPDR RIFCVDSVSF YASCECRYRN LPPLTTKLAV VSDLTRSGSV ILAASPALKQ        60
     LGIKTASRLY QIEQLPYRER KQIVLVEPRM LAYMKTSIEV LDVLHQFAPP DAIRIYSIDE       120
     NFVDMSGTER LFGSDTETAW KIQTAIWQQT GIPVRIGIGP NNVIAKLVLD LRGKREGIAQ       180
     CGYADVSRLL HDFPVRKMWG VGRMMEQHLS VMGIHTIGDL AAAPVEDLHE RFGVIGAELW       240
     HHAWGIDGSP TIIDPMTLFR TAPDTKRTIG HGVTLMRDYY QYEQIRLVLA ELASDVAARV       300
     RFSNQVGWTV HLGVRYSRHV ARDGFSKQLR LPYPTADERL LLRHILQLFE PNWLDGEPVR       360
     FLSVALGQLT PDQGTLQLSL FEDNTKVWRR KRLLKAIDHV NLRYGKGTIR LAVSFLDTSV       420
     AKRRLRFVGG HPGGDLHDTL S                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page