(data stored in ACNUC7421 zone)

EMBL: CP001022.PE419

CP001022.PE419       Location/Qualifiers
FT   CDS             complement(444242..444997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0425"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bpu:BPUM_0307 possible beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59907"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX7"
FT                   /protein_id="ACB59907.1"
FT                   /translation="MDIQQIRNATLVVNYANQVFLIDPFLGEKGSLPPFGETPNAVPNP
FT                   LVDLPVDVSTLLDPDAIFVTHLHADHFDETAKEILPKQIPLYAQNQADAATIREAGFTN
FT                   VSSFENGLALGDIRVYHTSGRHGVGEIGQRMGTVSGLVLTHPDEPTLYIAGDTIWCEEV
FT                   ETAIEQHAPDIIIVNSGAAQFLTGEPITMSQRDLLAVHQAAAEATIIVSHLESVNHCLL
FT                   RRDMIADFLAAHHLSAHFLIPDDGETISF"
     MDIQQIRNAT LVVNYANQVF LIDPFLGEKG SLPPFGETPN AVPNPLVDLP VDVSTLLDPD        60
     AIFVTHLHAD HFDETAKEIL PKQIPLYAQN QADAATIREA GFTNVSSFEN GLALGDIRVY       120
     HTSGRHGVGE IGQRMGTVSG LVLTHPDEPT LYIAGDTIWC EEVETAIEQH APDIIIVNSG       180
     AAQFLTGEPI TMSQRDLLAV HQAAAEATII VSHLESVNHC LLRRDMIADF LAAHHLSAHF       240
     LIPDDGETIS F                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page