(data stored in ACNUC7421 zone)

EMBL: CP001022.PE420

CP001022.PE420       Location/Qualifiers
FT   CDS             complement(445066..445575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0426"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bld:BLi01935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59908"
FT                   /db_xref="GOA:B1YIX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX8"
FT                   /protein_id="ACB59908.1"
FT                   /translation="MMIRPVKEDDLKDILAIYNEGIEDRIATLETDTKELSFMEDWYRE
FT                   RTPRYAGFVAYEGTTILGFISLDPYNPRPVYQSVGELSVYITRTHRGQGIGRQLLHVIE
FT                   EHAITQGFHKLILFTFPFNKIGQKLYIRSGFRIVGTFKEQGMLNGYYVDVLAMEKLLPK
FT                   TIDDQI"
     MMIRPVKEDD LKDILAIYNE GIEDRIATLE TDTKELSFME DWYRERTPRY AGFVAYEGTT        60
     ILGFISLDPY NPRPVYQSVG ELSVYITRTH RGQGIGRQLL HVIEEHAITQ GFHKLILFTF       120
     PFNKIGQKLY IRSGFRIVGT FKEQGMLNGY YVDVLAMEKL LPKTIDDQI                   169
//

If you have problems or comments...

PBIL Back to PBIL home page