(data stored in ACNUC7421 zone)

EMBL: CP001022.PE423

CP001022.PE423       Location/Qualifiers
FT   CDS             complement(446889..447548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0429"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; HAD-superfamily hydrolase subfamily IB
FT                   hypothetical 1; KEGG: gka:GK0954
FT                   2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59911"
FT                   /db_xref="GOA:B1YIY1"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR017718"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY1"
FT                   /protein_id="ACB59911.1"
FT                   /translation="MTIRILCDFDGTVTEHDNIIALMTEFAPPEAFEPLKKGVLDQSLS
FT                   IQSGVGQMFRLLPSDRKQDYIDFLEQRAVIRPGFKTLLAFAKSNGIDFAIVSGGIDFFV
FT                   QPILQELLTDEAIYCNGSDFSGETIRIEWPHTCDAACNNQCGCCKTSIARKLKQDGDII
FT                   VTIGDSVTDFELAKQADHVYARDYLITLCEQHGIAYTPFETFYDIVDHLQTTEVYA"
     MTIRILCDFD GTVTEHDNII ALMTEFAPPE AFEPLKKGVL DQSLSIQSGV GQMFRLLPSD        60
     RKQDYIDFLE QRAVIRPGFK TLLAFAKSNG IDFAIVSGGI DFFVQPILQE LLTDEAIYCN       120
     GSDFSGETIR IEWPHTCDAA CNNQCGCCKT SIARKLKQDG DIIVTIGDSV TDFELAKQAD       180
     HVYARDYLIT LCEQHGIAYT PFETFYDIVD HLQTTEVYA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page