(data stored in ACNUC7421 zone)

EMBL: CP001022.PE424

CP001022.PE424       Location/Qualifiers
FT   CDS             complement(447545..448735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0430"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /note="PFAM: ribulose bisphosphate carboxylase large chain;
FT                   KEGG: bpu:BPUM_1252 rmethionine salvage pathway
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59912"
FT                   /db_xref="GOA:B1YIY2"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR017717"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY2"
FT                   /protein_id="ACB59912.1"
FT                   /translation="MTYITATYQLGTTDQLPKRAEQIALGLTVGSWTDLNHLEQQQLES
FT                   FKGQVVHTEEHDGKGYITIRYPEHNVSRDFSAILTTVFGKLSLDGQIKLTDLQLPASFT
FT                   TDFPGAKFGIEGVRQLIQVHDRPLLMSIFKGVIGRDLTFLREQLEAQLAGGIDLVKDDE
FT                   ILYDNPLTPALDRARIGRDVLNAHYEKTGKRALYAITLSGSVFGLKDQTKRLIEAGATA
FT                   FLLNTFTYGLDVLRELAADPDISVPIFNHPALSGALIASPEYGIAAPVLLGTLPRLAGA
FT                   DLTLFPSPYGNVALAKDLARGIAVEATRIGETKTILPVPSAGIHPGLVAQLVHDFGTDS
FT                   VINAGGGVHGHPQGAAAGVLAFRQALDAALAGESLTSAATRQEELRVALDAWGITK"
     MTYITATYQL GTTDQLPKRA EQIALGLTVG SWTDLNHLEQ QQLESFKGQV VHTEEHDGKG        60
     YITIRYPEHN VSRDFSAILT TVFGKLSLDG QIKLTDLQLP ASFTTDFPGA KFGIEGVRQL       120
     IQVHDRPLLM SIFKGVIGRD LTFLREQLEA QLAGGIDLVK DDEILYDNPL TPALDRARIG       180
     RDVLNAHYEK TGKRALYAIT LSGSVFGLKD QTKRLIEAGA TAFLLNTFTY GLDVLRELAA       240
     DPDISVPIFN HPALSGALIA SPEYGIAAPV LLGTLPRLAG ADLTLFPSPY GNVALAKDLA       300
     RGIAVEATRI GETKTILPVP SAGIHPGLVA QLVHDFGTDS VINAGGGVHG HPQGAAAGVL       360
     AFRQALDAAL AGESLTSAAT RQEELRVALD AWGITK                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page