(data stored in ACNUC7421 zone)

EMBL: CP001022.PE426

CP001022.PE426       Location/Qualifiers
FT   CDS             450472..451518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0432"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: gtn:GTNG_0837 methylthioribose salvage
FT                   protein; TIGRFAM: translation initiation factor, aIF-2BI
FT                   family; eIF-2B alpha/beta/delta-related uncharacterized
FT                   protein; PFAM: initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59914"
FT                   /db_xref="GOA:B1YIY4"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY4"
FT                   /protein_id="ACB59914.1"
FT                   /translation="MSQFVQSIIYENRTVTILDQTRLPEEEHYEIIHDLAQAIDAIKQL
FT                   RVRGAPAISLFGGFVLVQEAFRTTGTLAEAKQELLEVSAQLLATRPTAVNLRNVLDELN
FT                   QLIVSATTLKELPVRLEQKALELYQTDAKTSRQIGVHALELFESGDRVLTICNAGSIAT
FT                   AAYGTALAPFYLAKEQGIPLSVYASETRPLLQGARLTTWELQRAGIDVTLITDNMVAHT
FT                   IKEKQITAIIVGADRITRNGDTANKIGTFQLALLARAFGIPFYVAAPLSTFDFTSLSGD
FT                   EIEIEERDAREVTQLAGKATAPAGVPVFNPAFDVTPHDLITAIITELGVIEHPDVETIK
FT                   RTIGQHTH"
     MSQFVQSIIY ENRTVTILDQ TRLPEEEHYE IIHDLAQAID AIKQLRVRGA PAISLFGGFV        60
     LVQEAFRTTG TLAEAKQELL EVSAQLLATR PTAVNLRNVL DELNQLIVSA TTLKELPVRL       120
     EQKALELYQT DAKTSRQIGV HALELFESGD RVLTICNAGS IATAAYGTAL APFYLAKEQG       180
     IPLSVYASET RPLLQGARLT TWELQRAGID VTLITDNMVA HTIKEKQITA IIVGADRITR       240
     NGDTANKIGT FQLALLARAF GIPFYVAAPL STFDFTSLSG DEIEIEERDA REVTQLAGKA       300
     TAPAGVPVFN PAFDVTPHDL ITAIITELGV IEHPDVETIK RTIGQHTH                    348
//

If you have problems or comments...

PBIL Back to PBIL home page