(data stored in ACNUC7421 zone)

EMBL: CP001022.PE432

CP001022.PE432       Location/Qualifiers
FT   CDS             457550..459622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0438"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   oih:OB0715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59920"
FT                   /db_xref="GOA:B1YIZ0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ0"
FT                   /protein_id="ACB59920.1"
FT                   /translation="MMRRLIWNLLAGLLFASFMPPLLELTTFESVIPFLPLLLTPLLLS
FT                   HVRRSWFLLGSLLALLVSFYLILIPGEAPWNLFREIAGDINRVINGELPGRPAFAFSIG
FT                   LISFLIGYLARRTFPNRGFVFGLALGVIGFIAYCDTWTDYSGEQFIIYPIVLALFLLYA
FT                   TEVSERPMASYVRPFSALLIIGATVVAAVQSPVITATWQDSWYDWTDGFESEGTSSSQI
FT                   QKVGYGNNDEQLGGPFQMDDREVFQVESEGSRYWRVETKDVYTGKGWVLSKSEPEIDSR
FT                   GFFSHFGDDVKKREERATFELSRELPFVPYNGDNVRLSVDKQRQNLLIDPENQKVSYLD
FT                   DAERQQNYQIQYTYPLFTEELLQTDEPITLSEMEQDRYLQLPDTLPNRVRDLAEEIVAD
FT                   EDSPWDKAKAIESYFEQENFEYNTEEVAVPEENQDYVDQFLFETKLGYCDNFSTSATVL
FT                   LRAVGLPARWVKGFTGGESDVIGAAVTSYTVRNKNAHSWVEVYIEGPGWVPLEPTVSFD
FT                   GAGQYTIDQETNNETEQANPQRDTETDTETATPERPQENLLDEEQTTTAAQTEQQSFPI
FT                   WPVVGVIVGLVFLYLFRKPLTRTAAILFFRNQLHRPEGFKRMYRFLLRRLDKQGFHYKD
FT                   GRTLTELAHEVDGYYETYAMRPLTDAYERMVYGGESLSVDKKREYFENIIRRIEG"
     MMRRLIWNLL AGLLFASFMP PLLELTTFES VIPFLPLLLT PLLLSHVRRS WFLLGSLLAL        60
     LVSFYLILIP GEAPWNLFRE IAGDINRVIN GELPGRPAFA FSIGLISFLI GYLARRTFPN       120
     RGFVFGLALG VIGFIAYCDT WTDYSGEQFI IYPIVLALFL LYATEVSERP MASYVRPFSA       180
     LLIIGATVVA AVQSPVITAT WQDSWYDWTD GFESEGTSSS QIQKVGYGNN DEQLGGPFQM       240
     DDREVFQVES EGSRYWRVET KDVYTGKGWV LSKSEPEIDS RGFFSHFGDD VKKREERATF       300
     ELSRELPFVP YNGDNVRLSV DKQRQNLLID PENQKVSYLD DAERQQNYQI QYTYPLFTEE       360
     LLQTDEPITL SEMEQDRYLQ LPDTLPNRVR DLAEEIVADE DSPWDKAKAI ESYFEQENFE       420
     YNTEEVAVPE ENQDYVDQFL FETKLGYCDN FSTSATVLLR AVGLPARWVK GFTGGESDVI       480
     GAAVTSYTVR NKNAHSWVEV YIEGPGWVPL EPTVSFDGAG QYTIDQETNN ETEQANPQRD       540
     TETDTETATP ERPQENLLDE EQTTTAAQTE QQSFPIWPVV GVIVGLVFLY LFRKPLTRTA       600
     AILFFRNQLH RPEGFKRMYR FLLRRLDKQG FHYKDGRTLT ELAHEVDGYY ETYAMRPLTD       660
     AYERMVYGGE SLSVDKKREY FENIIRRIEG                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page