(data stored in ACNUC7421 zone)

EMBL: CP001022.PE436

CP001022.PE436       Location/Qualifiers
FT   CDS             463693..464562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0442"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: oih:OB3032
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59924"
FT                   /db_xref="GOA:B1YIZ4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ4"
FT                   /protein_id="ACB59924.1"
FT                   /translation="MNGRDRVYDHAKLILIFLVVLGHIIEPFISKSRGLEGIFNFIYLF
FT                   HMPAFIFISGYFTKGKLTFRTGLKLSLDYFVLFIMIQLVFVAVMKGIGIDQYQFLTVQP
FT                   AYIYWYLFAMFVWSLMLPAALWLGRSVKIGIGRVFLVSVLVALGAGYIDQIGWAWSLSR
FT                   IVVFFPFFVLGYYFKSRGWIIYQVFPNRWMALAVMLAGALMMWIWPDLFQFNLVSGANS
FT                   YAKIGLNDTGLIVRLVLYLTQWMMIMAFFTLLPKRPFVLSHLGTKTLTIYILHGFIVKG
FT                   LIATAYFN"
     MNGRDRVYDH AKLILIFLVV LGHIIEPFIS KSRGLEGIFN FIYLFHMPAF IFISGYFTKG        60
     KLTFRTGLKL SLDYFVLFIM IQLVFVAVMK GIGIDQYQFL TVQPAYIYWY LFAMFVWSLM       120
     LPAALWLGRS VKIGIGRVFL VSVLVALGAG YIDQIGWAWS LSRIVVFFPF FVLGYYFKSR       180
     GWIIYQVFPN RWMALAVMLA GALMMWIWPD LFQFNLVSGA NSYAKIGLND TGLIVRLVLY       240
     LTQWMMIMAF FTLLPKRPFV LSHLGTKTLT IYILHGFIVK GLIATAYFN                   289
//

If you have problems or comments...

PBIL Back to PBIL home page