(data stored in ACNUC7421 zone)

EMBL: CP001022.PE441

CP001022.PE441       Location/Qualifiers
FT   CDS             474480..474971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0447"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: lwe:lwe1793 phosphoribosylaminoimidazole
FT                   carboxylase I; TIGRFAM: phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59929"
FT                   /db_xref="GOA:B1YIZ9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ9"
FT                   /protein_id="ACB59929.1"
FT                   /translation="MSKVEIGVIMGSQSDWVTMQKTCDVLDQLDIGYEKKVVSAHRTPD
FT                   LMFRYAESARERGLKVIIAGAGGAAHLPGMVAAKTTLPVIGVPIQSKALQGIDSLLSIV
FT                   QMPGGVPVATVAIGDAGAKNAGLLAAQILGTVDERIARALDHMRVELEGDVIASEVYLT
FT                   "
     MSKVEIGVIM GSQSDWVTMQ KTCDVLDQLD IGYEKKVVSA HRTPDLMFRY AESARERGLK        60
     VIIAGAGGAA HLPGMVAAKT TLPVIGVPIQ SKALQGIDSL LSIVQMPGGV PVATVAIGDA       120
     GAKNAGLLAA QILGTVDERI ARALDHMRVE LEGDVIASEV YLT                         163
//

If you have problems or comments...

PBIL Back to PBIL home page